Again, you are making false claims about abiogenesis and the context of probability in leading theories. You should probably learn before you speak
Abiogenesis hass both chemical and a biological components which are not random, not to mention natural selection of self replicating polymers is not a random process. Why do you continue to give in to creationist propaganda. It’s lazy even for you.
so you are guilty of every known crime committed by US military since you have been an adult. You know innocents are killed in conflict. It is a secret that everyone knows. But here you are… allowing it.
If for some reason we were in a huge war with China and our forces committed some serious war crimes, like attempted genocide, I would not expect the invading Chinese forces to be very kind to us. The same goes for them.
I will use as an example the "self-replicating" peptide from the Ghadiri group mentioned above [7]. I could use other examples, such as the hexanucleotide self-replicator [10], the SunY self-replicator [24] or the RNA polymerase described by the Eckland group [12], but for historical continuity with creationist claims a small peptide is ideal. This peptide is 32 amino acids long with a sequence of RMKQLEEKVYELLSKVACLEYEVARLKKVGE and is an enzyme, a peptide ligase that makes a copy of itself from two 16 amino acid long subunits. It is also of a size and composition that is ideally suited to be formed by abiotic peptide synthesis. The fact that it is a self replicator is an added irony.
The probability of generating this in successive random trials is (1/20)32 or 1 chance in 4.29 x 1040. This is much, much more probable than the 1 in 2.04 x 10390 of the standard creationist “generating carboxypeptidase by chance” scenario, but still seems absurdly low.
And…? Oh, I see you don’t think experiments that give rise to the probability of an abiogenesis hypothesis are good for your creationist propaganda? LOL
Let’s make this easy, if you can’t have an adult conversation absent all of the childish insults and BS go bother someone else. You don’t even understand the most basic concepts of life or what it would take to create it.
The argument is not complete randomness or god, the argument is of intention by a conscious being or not. You are promoting a false dichotomy. There are causal mechanisms involved, none that have conscious intent like a human would have. The pencil box has hardly any relevance other than the desperate attempts of creationists to stifle scientific inquiry. As for exact right time… do you know how vast the habitable zone is for the earth?